PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca53956.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 350aa    MW: 39356.2 Da    PI: 6.6351
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca53956.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.68.8e-48181371129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL+ kv ++++++ ++i evd++k+         k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++l
  Dca53956.1  18 LPPGFRFHPTDEELITHYLALKVVDDDFSA-RAIGEVDLNKWRA-------KMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIIR-GKAL 107
                 79**************************99.89******99752.......23789*************************************9.99** PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg+kktLvfykgrapkgek++Wvmheyrle
  Dca53956.1 108 VGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 137
                 ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5713161IPR003441NAC domain
PROSITE profilePS5100552.31118161IPR003441NAC domain
PfamPF023651.4E-2819136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MENMGMVVGD NEHEVMDLPP GFRFHPTDEE LITHYLALKV VDDDFSARAI GEVDLNKWRA  60
KMGEKEWYFF CVRDRKYPTG LRTNRATEAG YWKATGKDKE IIRGKALVGM KKTLVFYKGR  120
APKGEKSNWV MHEYRLEGKA SLQNLPPNAK NEWVICRVFQ KSAAGKKIPF TGLMRPESIN  180
PEFNPSGNLP PLMESSPHVS CFSNQINNST NTAQTSHYYN TNQPSFDGLI TNNPFNTIPP  240
NSITGYLPRI GSVNPYFQPQ TGPFLGNYVM SDQNILRAIL NNQGTETKQG MKTEVVNYSA  300
SQDTGLSSDM NNAEISSVVS TYDMGRRTID EHDGPSTSDG PIDLENLWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-491616715171NAC domain-containing protein 19
4dul_A1e-491616715171NAC domain-containing protein 19
1ut7_B1e-491616715171NO APICAL MERISTEM PROTEIN
1ut7_A1e-491616715171NO APICAL MERISTEM PROTEIN
1ut4_B1e-491616715171NO APICAL MERISTEM PROTEIN
1ut4_A1e-491616715171NO APICAL MERISTEM PROTEIN
3swp_D1e-491616718174NAC domain-containing protein 19
3swp_C1e-491616718174NAC domain-containing protein 19
3swp_B1e-491616718174NAC domain-containing protein 19
3swp_A1e-491616718174NAC domain-containing protein 19
3swm_D1e-491616718174NAC domain-containing protein 19
3swm_C1e-491616718174NAC domain-containing protein 19
3swm_B1e-491616718174NAC domain-containing protein 19
3swm_A1e-491616718174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678483.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-124NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0J8CFJ40.0A0A0J8CFJ4_BETVU; Uncharacterized protein
STRINGPOPTR_0015s02170.11e-130(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-123NAC domain containing protein 100